CDH1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA004812

 

Antibody CAB000087

 

Antibody CAB028364

 

Antibody CAB072855

 

Antibody CAB072856

 

Antibody CAB072857

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Zymed
 ECM Biosciences
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA004812 13-1700 CM1681 AMAb90862 AMAb90863 AMAb90865 

Host species

Rabbit Mouse Mouse Mouse Mouse Mouse 

Clonality

pAb mAb mAb mAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Protein A/G Protein A/G Protein A/G Protein A/G 

Released in version

3 1 6 14 14 14 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known Recombinant protein Recombinant protein Recombinant protein Recombinant protein 

Length (aa)

125      

Antigen sequence

ATDNGSPVATGTGTLLLILSDVNDNAPIPEPRTIFFCERNPKPQVINIID
ADLPPNTSPFTAELTHGASANWTIQYNDPTQESIILKPKMALEVGDYKIN
LKLMDNQNKDQVTTLEVSVCDCEGA
 
 
 
 
 
 

Matching transcripts

CDH1-001 - ENSP00000261769 [100%]
CDH1-004 - ENSP00000414946 [100%]
CDH1-201 - ENSP00000481063 [100%]
      

Other gene match

      

ANTIBODY VALIDATION

         Immunohistochemistry

Image

      

Description

Immunohistochemical staining of human kidney shows membranous positivity in distal tubules.
More information
 Immunohistochemical staining of human duodenum shows strong membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human prostate shows strong membranous and cytoplasmic positivity in glandular cells.
More information
 Immunohistochemical staining of human stomach shows membranous positivity in glandular cells.
More information
 Immunohistochemical staining of human esophagus shows strong membranous positivity in squamous epithelial cells.
More information
 Immunohistochemical staining of human stomach shows membranous positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:300 1:10000 1:450 1:750 1:1000 1:850 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Consistent with RNA expression data Consistent with RNA expression data Consistent with RNA expression data Consistent with RNA expression data Consistent with RNA expression data Consistent with RNA expression data 

         Immunofluorescence

Image

      

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane, cytoplasm & focal adhesion sites.
More information
 Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane & the Golgi apparatus.
More information
 Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:24  1:112    

Validation IF

Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody.  Supportive: The subcellular location is supported by experimental gene/protein characterization data, gene silencing, or an independent antibody.    

         Western Blot

Image

      

Description

Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

100.0, 97.5, 90.9 100.0, 97.5, 90.9, 71.4, 71.3 100.0, 97.5, 90.9, 71.4, 71.3 100.0, 97.5, 90.9, 71.4, 71.3 100.0, 97.5, 90.9, 71.4, 71.3 100.0, 97.5, 90.9, 71.4, 71.3 

Antibody dilution

1:250 1:500 1:500 1:500 1:500 1:500 

Validation WB

Uncertain: Single band larger than predicted size in kDa (+20%) but partly supported by experimental and/or bioinformatic data Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Weak band of predicted size but with additional bands of higher intensity also present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

      

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000      

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.      
 

ANTIGEN VIEW

? »
 
 
 
CDH1-001
 
CDH1-004
 
CDH1-201