ARHGEF1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA012924

 

Antibody HPA060784

 

Antibody CAB009502

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA012924 HPA060784 sc-20804 

Host species

Rabbit Rabbit Rabbit 

Clonality

pAb pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

4 13 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein 

Length (aa)

114 115  

Antigen sequence

YMRHLGVRTKSGDKKSGRNFFRKKVMGNRRSDEPAKTKKGLSSILDAARW
NRGEPQVPDFRHLKAEVDAEKPGATDRKGGVGMPSRDRNIGAPGQDTPGV
SLHPLSLDSPDREP
 
LRVPVPPNVAFELDRTRADLISEDVQRRFVQEVVQSQQVAVGRQLEDFRS
KRLMGMTPWEQELAQLEAWVGRDRASYEARERHVAERLLMHLEEMQHTIS
TDEEKSAAVVNAIGL
 
 

Matching transcripts

ARHGEF1-001 - ENSP00000344429 [100%]
ARHGEF1-005 - ENSP00000346532 [100%]
ARHGEF1-006 - ENSP00000337261 [100%]
ARHGEF1-007 - ENSP00000367394 [100%]
ARHGEF1-010 - ENSP00000470715 [100%]
 ARHGEF1-001 - ENSP00000344429 [100%]
ARHGEF1-005 - ENSP00000346532 [100%]
ARHGEF1-006 - ENSP00000337261 [100%]
ARHGEF1-007 - ENSP00000367394 [100%]
ARHGEF1-010 - ENSP00000470715 [100%]
  

Other gene match

   

ANTIBODY VALIDATION

         Immunohistochemistry

Image

   

Description

Immunohistochemical staining of human lymph node shows strong cytoplasmic positivity.
More information
 Application not done for this antibody. Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in reaction center cells and lymphoid cells outside reaction centra.
More information
 

Retrieval method

HIER pH6  HIER pH6 

Antibody dilution

1:600  1:250 

Literature conformity

Consistent with extensive gene/protein characterization data  Consistent with extensive gene/protein characterization data 

RNA consistency

Not done  Not done 

         Immunofluorescence

Image

   

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane & cytoplasm.
More information
 Immunofluorescent staining of human cell line A549 shows positivity in cytoplasm.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane & cytoplasm.
More information
 

Antibody dilution

1:200 1:43 1:62 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

   

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

108.3, 105.9, 104.1, 102.4, 98.8 108.3, 105.9, 104.1, 102.4, 98.8 108.3, 105.9, 104.1, 102.4, 98.8, 78.5, 34.2, 32.8, 30.0, 13.9, 10.2, 7.5 

Antibody dilution

1:250 1:100 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

   

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:1750  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
ARHGEF1-001
 
ARHGEF1-005
 
ARHGEF1-006
 
ARHGEF1-007
 
ARHGEF1-010