ATRX

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001906

 

Antibody HPA064684

 

Antibody CAB009372

 

Antibody CAB068176

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 Atlas Antibodies
 

Product name

HPA001906 HPA064684 sc-15408 AMAb90784 

Host species

Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G Protein A/G 

Released in version

2 13 3 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein Recombinant protein 

Length (aa)

141 96   

Antigen sequence

AAWAEYEAEKKGLTMRFNIPTGTNLPPVSFNSQTPYIPFNLGALSAMSNQ
QLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLSEAQVQAL
ALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILMNRR
 
EFRAMDAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISKSEAKLS
RKQVDSEHMHQNVPTEEQRTNKSTGGEHKKSDRKEEPQYEPANTSE
 
 
 

Matching transcripts

ATRX-001 - ENSP00000362441 [100%]
ATRX-002 - ENSP00000378967 [100%]
 ATRX-001 - ENSP00000362441 [100%]
ATRX-002 - ENSP00000378967 [100%]
   

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human pancreas shows strong nuclear positivity in exocrine glandular cells and islet cells.
More information
 Application not done for this antibody. Immunohistochemical staining of human stomach shows strong nuclear positivity in glandular cells.
More information
 Immunohistochemical staining of human urinary bladder shows strong nuclear positivity in urothelial cells.
More information
 

Retrieval method

HIER pH6  HIER pH6 HIER pH6 

Antibody dilution

1:1500  1:300 1:500 

Literature conformity

Partly consistent with extensive gene/protein characterization data  Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Mainly consistent with RNAseq data  Consistent with RNAseq data Consistent with RNAseq data 

         Western Blot

Image

    

Description

Target too small/large to be analyzed with the present setup  Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

282.6, 278.2 282.6, 278.2 282.6, 278.2, 18.5, 14.0 282.6, 278.2, 18.5, 14.0 

Antibody dilution

 1:720 1:500 1:1000 

Validation WB

Target too small/large to be analyzed with the present setup Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000 1:8600   

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). Supportive: Pass with single peak corresponding to interaction only with its own antigen.   

         Immunofluorescence

Image

    

Description

Application not done for this antibody. Immunofluorescent staining of human cell line RH-30 shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. 

Antibody dilution

 1:200 1:20  

Validation IF

 Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature.  
 

ANTIGEN VIEW

? »
 
 
 
ATRX-001
 
ATRX-002