MAPK1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA003995

 

Antibody HPA005700

 

Antibody HPA030069

 

Antibody CAB004229

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Santa Cruz Biotechnology
 

Product name

HPA003995 HPA005700 HPA030069 sc-1647 

Host species

Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

3 3 6 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Synthetic peptide 

Length (aa)

138 131 27  

Antigen sequence

YVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQ
LNHILGILGSPSQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDSKA
LDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPV
 
EVEMVKGQPFDVGPRYTQLQYIGEGAYGMVSSAYDHVRKTRVAIKKISPF
EHQTYCQRTLREIQILLRFRHENVIGIRDILRASTLEAMRDVYIVQDLME
TDLYKLLKSQQLSNDHICYFLYQILRGLKYI
 
YIVQDLMETDLYKLLKTQHLSNDHICY
 
 

Matching transcripts

MAPK1-001 - ENSP00000215832 [89%]
MAPK1-002 - ENSP00000381803 [89%]
 MAPK1-001 - ENSP00000215832 [85%]
MAPK1-002 - ENSP00000381803 [85%]
MAPK1-201 - ENSP00000440842 [85%]
 MAPK1-001 - ENSP00000215832 [100%]
MAPK1-002 - ENSP00000381803 [100%]
MAPK1-201 - ENSP00000440842 [100%]
  

Other gene match

MAPK3 - ENSG00000102882 [100%]
 MAPK3 - ENSG00000102882 [100%]
 MAPK3 - ENSG00000102882 [93%]
  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Immunohistochemical staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human skeletal muscle shows cytoplasmic positivity in myocytes.
More information
 Immunohistochemical staining of human skeletal muscle shows moderate cytoplasmic positivity.
More information
 Immunohistochemical staining of human skeletal muscle shows weak positivity in myocytes.
More information
 

Retrieval method

HIER pH6 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:25 1:20 1:70 1:2000 

Literature conformity

Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done Not done 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in microtubules & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-2 OS shows no positivity.
More information
 

Antibody dilution

1:36  1:20 1:2000 

Validation IF

Supportive: The subcellular location is supported by literature.  Supportive: The subcellular location is supported by literature. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400968)
More information
 Lane 1: Marker [kDa] 220, 112, 84, 47, 32, 26, 16.8
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

43.1, 41.4, 40.1, 38.5, 36.0, 30.6 43.1, 41.4, 40.1, 38.5, 38.3, 36.4, 36.0, 35.7 43.1, 41.4, 40.1, 38.5, 38.3, 36.4, 36.0, 35.7, 30.6, 10.2 41.4, 36.4 

Antibody dilution

1:250 1:250 1:250 1:500 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:3000 1:500 1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
MAPK1-001
 
MAPK1-002
 
MAPK1-201