CHGA

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA017369

 

Antibody CAB000023

 

Antibody CAB040544

 

Antibody CAB055506

 

Antibody CAB058688

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Roche
 NCI-CPTC
 DakoCytomation
 Atlas Antibodies
 

Product name

HPA017369 1199 021 CPTC-CHGA-2 M0869 AMAb90525 

Host species

Rabbit Mouse Mouse Mouse Mouse 

Clonality

pAb mAb mAb mAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Not known Protein A/G Supernatant Protein A/G 

Released in version

4 1 7 11 12 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Not known Recombinant protein Native protein Recombinant protein 

Length (aa)

141     

Antigen sequence

NSPMNKGDTEVMKCIVEVISDTLSKPSPMPVSQECFETLRGDERILSILR
HQNLLKELQDLALQGAKERAHQQKKHSGFEDELSEVLENQSSQAELKEAV
EEPSSKDVMEKREDSKEAEKSGEATDGARPQALPEPMQESK
 
 
 
 
 

Matching transcripts

CHGA-001 - ENSP00000216492 [100%]
     

Other gene match

     

ANTIBODY VALIDATION

         Immunohistochemistry

Image

     

Description

Immunohistochemical staining of human rectum shows strong cytoplasmic positivity in subset of glandular cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islet cells.
More information
 Immunohistochemical staining of human stomach shows strong cytoplasmic positivity in enterochromaffin cells.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
More information
 Immunohistochemical staining of human pancreas shows strong cytoplasmic positivity in islets of Langerhans.
More information
 

Retrieval method

HIER pH6 HIER pH9 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

1:600 1:5000 1:275 1:2000 1:2000 

Literature conformity

Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

Not done Not done Not done Not done Consistent with RNAseq data 

         Western Blot

Image

     

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY400511)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

50.7 50.7, 34.3, 4.0 50.7, 34.3, 4.0 50.7, 34.3, 4.0 50.7, 34.3, 4.0 

Antibody dilution

1:250 1:500 1:250 1:500 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Uncertain: No bands detected Non-supportive: Only bands not corresponding to the predicted size Uncertain: No bands detected 

         Immunofluorescence

Image

     

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in cytoplasm & nucleus but excluded from the nucleoli.
More information
 Application not done for this antibody. Immunofluorescent staining of human cell line A-431 shows positivity in cytoplasm.
More information
 Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:49  1:200   

Validation IF

Uncertain: The subcellular location is partly supported by literature or no literature is available.  Uncertain: The subcellular location is partly supported by literature or no literature is available.   

         Protein array

Image

     

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. Application not done for this antibody. 

Antibody dilution

1:3000     

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.     
 

ANTIGEN VIEW

? »
 
 
 
CHGA-001