CHRDL1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000226

 

Antibody HPA000250

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000226 HPA000250 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

112 115 

Antigen sequence

EELPGQSFDNKGYFCGEETMPVYESVFMEDGETTRKIALETERPPQVEVH
VWTIRKGILQHFHIEKISKRMFEELPHFKLVTRTTLSQWKIFTEGEAQIS
QMCSSRVCRTEL
 
DKKYRVGERWHPYLEPYGLVYCVNCICSENGNVLCSRVRCPNVHCLSPVH
IPHLCCPRCPEDSLPPVNNKVTSKSCEYNGTTYQHGELFVAEGLFQNRQP
NQCTQCSCSEGNVYC
 

Matching transcripts

CHRDL1-002 - ENSP00000361112 [100%]
CHRDL1-005 - ENSP00000418443 [100%]
CHRDL1-006 - ENSP00000399739 [100%]
CHRDL1-001 - ENSP00000361115 [99%]
CHRDL1-004 - ENSP00000378276 [99%]
CHRDL1-201 - ENSP00000218054 [99%]
CHRDL1-202 - ENSP00000389627 [99%]
 CHRDL1-002 - ENSP00000361112 [100%]
CHRDL1-001 - ENSP00000361115 [99%]
CHRDL1-004 - ENSP00000378276 [99%]
CHRDL1-006 - ENSP00000399739 [99%]
CHRDL1-201 - ENSP00000218054 [99%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows cytoplasmic positivity in renal tubules.
More information
 Immunohistochemical staining of human kidney shows strong cytoplasmic and membranous positivity in renal tubules.
More information
 

Retrieval method

HIER pH9 HIER pH6 

Antibody dilution

1:20 1:200 

Literature conformity

No avaliable characterization data No avaliable characterization data 

RNA consistency

Not done Not done 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407971)
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: Negative control (vector only transfected HEK293T lysate)
Lane 3: Over-expression Lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY407971)
More information
 

Target mass (kDa)

52.3, 52.2, 52.0, 51.2, 43.5, 43.4 52.3, 52.2, 52.0, 51.2 

Antibody dilution

1:250 1:250 

Validation WB

Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:1000 1:2000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
CHRDL1-001
 
CHRDL1-002
 
CHRDL1-004
 
CHRDL1-005
 
CHRDL1-006
 
CHRDL1-201
 
CHRDL1-202