FN1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA027066

 

Antibody CAB000126

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 DakoCytomation
 

Product name

HPA027066 A0245 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Protein A/G 

Released in version

6 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Native protein 

Length (aa)

130  

Antigen sequence

HEEICTTNEGVMYRIGDQWDKQHDMGHMMRCTCVGNGRGEWTCIAYSQLR
DQCIVDDITYNVNDTFHKRHEEGHMLNCTCFGQGRGRWKCDPVDQCQDSE
TGTFYQIGDSWEKYVHGVRYQCYCYGRGIG
 
 

Matching transcripts

FN1-001 - ENSP00000346839 [100%]
FN1-002 - ENSP00000323534 [100%]
FN1-003 - ENSP00000338200 [100%]
FN1-004 - ENSP00000350534 [100%]
FN1-005 - ENSP00000394423 [100%]
FN1-008 - ENSP00000410422 [100%]
FN1-009 - ENSP00000415018 [100%]
FN1-012 - ENSP00000399538 [100%]
FN1-013 - ENSP00000348285 [100%]
FN1-014 - ENSP00000398907 [100%]
FN1-201 - ENSP00000273049 [100%]
FN1-202 - ENSP00000265312 [100%]
FN1-203 - ENSP00000349509 [100%]
FN1-204 - ENSP00000352696 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in subsets of tubules.
More information
 Immunohistochemical staining of skin shows staing in dermal connective tissue.
More information
 

Retrieval method

HIER pH6 HIER pH9 

Antibody dilution

1:25 1:12800 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

272.3, 268.9, 262.6, 259.2, 256.5, 252.8, 249.4, 249.3, 246.7, 243.2, 240.5, 239.6, 223.0, 73.7 272.3, 268.9, 262.6, 259.2, 256.5, 252.8, 249.4, 249.3, 246.7, 243.2, 240.5, 239.6, 223.0, 120.8, 73.7, 26.6 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:500  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 « 
 
FN1-001
 
FN1-002
 
FN1-003
 
FN1-004
 
FN1-005
 
FN1-008
 
FN1-009
 
FN1-012
 
FN1-013
 
FN1-014
 
FN1-201
 
FN1-202
 
FN1-203
 
FN1-204
 
 »