SETDB1

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA018142

 

Antibody HPA058484

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA018142 HPA058484 

Host species

Rabbit Rabbit 

Clonality

pAb pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

4 13 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment 

Length (aa)

148 97 

Antigen sequence

KLRFLIFFDDGYASYVTQSELYPICRPLKKTWEDIEDISCRDFIEEYVTA
YPNRPMVLLKSGQLIKTEWEGTWWKSRVEEVDGSLVRILFLDDKRCEWIY
RGSTRLEPMFSMKTSSASALEKKQGQLRTRPNMGAVRSKGPVVQYTQD
 
SGTSRKPTAGQTSATAVDSDDIQTISSGSEGDDFEDKKNMTGPMKRQVAV
KSTRGFALKSTHGIAIKSTNMASVDKGESAPVRKNTRQFYDGEESCY
 

Matching transcripts

SETDB1-001 - ENSP00000271640 [100%]
SETDB1-005 - ENSP00000432348 [100%]
SETDB1-013 - ENSP00000436148 [100%]
SETDB1-014 - ENSP00000357965 [100%]
 SETDB1-001 - ENSP00000271640 [100%]
SETDB1-005 - ENSP00000432348 [100%]
SETDB1-014 - ENSP00000357965 [100%]
 

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human colon shows strong nuclear, cytoplasmic and membranous positivity in glandular cells.
More information
 Application not done for this antibody. 

Retrieval method

HIER pH6  

Antibody dilution

1:550  

Literature conformity

Partly consistent with extensive gene/protein characterization data  

RNA consistency

Not done  

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane, cytoplasm & nucleus but excluded from the nucleoli.
More information
 Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but excluded from the nucleoli.
More information
 

Antibody dilution

1:200 1:128 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

143.2, 143.0, 139.4, 71.0 143.2, 143.0, 139.4 

Antibody dilution

1:250 1:430 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 1:5100 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
SETDB1-001
 
SETDB1-005
 
SETDB1-013
 
SETDB1-014