TK2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA041162

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA041162 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

9 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

96 

Antigen sequence

YVVLSEWFDWILRNMDVSVDLIVYLRTNPETCYQRLKKRCREEEKVIPLE
YLEAIHHLHEEWLIKGSLFPMAAPVLVIEADHHMERMLELFEQNRD
 

Matching transcripts

TK2-001 - ENSP00000414334 [100%]
TK2-002 - ENSP00000433770 [100%]
TK2-003 - ENSP00000434594 [100%]
TK2-004 - ENSP00000435312 [100%]
TK2-005 - ENSP00000407469 [100%]
TK2-008 - ENSP00000438143 [100%]
TK2-009 - ENSP00000463560 [100%]
TK2-201 - ENSP00000299697 [100%]
TK2-202 - ENSP00000440898 [100%]
TK2-014 - ENSP00000455187 [85%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in renal tubules.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:275 

Validation IH

Uncertain: One antibody yielding a staining pattern which is partly consistent with gene/protein characterization data or consistent with limited gene/protein characterization data 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

35.4, 32.9, 31.0, 28.9, 28.4, 27.6, 25.5, 20.3 

Antibody dilution

1:250 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:30000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
TK2-001
 
TK2-002
 
TK2-003
 
TK2-004
 
TK2-005
 
TK2-008
 
TK2-009
 
TK2-014
 
TK2-201
 
TK2-202