FLNA

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000368

 

Antibody HPA001115

 

Antibody HPA002925

 

Antibody CAB000356

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 Atlas Antibodies
Sigma-Aldrich
 AbD Serotec
 

Product name

HPA000368 HPA001115 HPA002925 MCA464 

Host species

Rabbit Rabbit Rabbit Mouse 

Clonality

pAb pAb pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Affinity purified using the PrEST-antigen as affinity ligand Not known 

Released in version

2 2 2 1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Recombinant protein fragment Recombinant protein fragment Not known 

Length (aa)

119 113 149  

Antigen sequence

FQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQTWAPERPLVGVNGLDV
TSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTITDNKDGTVTVRYAPS
EAGLHEMDIRYDNMHIPGS
 
IKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANVGSHCDLSLKIP
EISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGTHTVSVKYK
GQHVPGSPFQFTV
 
VICVRFGGEHVPNSPFQVTALAGDQPSVQPPLRSQQLAPQYTYAQGGQQT
WAPERPLVGVNGLDVTSLRPFDLVIPFTIKKGEITGEVRMPSGKVAQPTI
TDNKDGTVTVRYAPSEAGLHEMDIRYDNMHIPGSPLQFYVDYVNCGHVT
 
 

Matching transcripts

FLNA-001 - ENSP00000353467 [100%]
FLNA-002 - ENSP00000358866 [100%]
FLNA-015 - ENSP00000398215 [100%]
FLNA-202 - ENSP00000416926 [100%]
 FLNA-001 - ENSP00000353467 [100%]
FLNA-002 - ENSP00000358866 [100%]
FLNA-010 - ENSP00000358863 [100%]
FLNA-201 - ENSP00000358872 [100%]
FLNA-202 - ENSP00000416926 [100%]
 FLNA-001 - ENSP00000353467 [100%]
FLNA-002 - ENSP00000358866 [100%]
FLNA-015 - ENSP00000398215 [100%]
FLNA-202 - ENSP00000416926 [100%]
  

Other gene match

    

ANTIBODY VALIDATION

         Immunohistochemistry

Image

    

Description

Application not done for this antibody. Immunohistochemical staining of human smooth muscle shows strong cytoplasmic positivity in smooth muscle cells.
More information
 Immunohistochemical staining of human bone marrow shows strong cytoplasmic positivity in bone marrow poietic cells.
More information
 Immunohistochemical staining of human breast shows strong cytoplasmic positivity in myoepithelial cells.
More information
 

Retrieval method

 HIER pH6 HIER pH6 HIER pH6 

Antibody dilution

 1:100 1:500 1:150 

Literature conformity

 Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data Consistent with extensive gene/protein characterization data 

RNA consistency

 Not done Not done Not done 

         Immunofluorescence

Image

    

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in plasma membrane, cytoplasm & actin filaments.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in cytoplasm & actin filaments.
More information
 Immunofluorescent staining of human cell line U-2 OS shows positivity in plasma membrane, cytoplasm & actin filaments.
More information
 Immunofluorescent staining of human cell line A-431 shows positivity in plasma membrane, cytoplasm & actin filaments.
More information
 

Antibody dilution

1:143 1:20 1:111 1:37 

Validation IF

Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

    

Description

Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 Lane 1: Marker [kDa] 219, 112, 85, 49, 32, 25, 17.5
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
  Lane 1: Marker [kDa] 230, 110, 82, 49.3, 32.2, 25.5, 17.6
Lane 2: RT4
Lane 3: U-251 MG
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

280.7, 280.0, 25.0 280.7, 280.0, 276.5, 82.5 280.7, 280.0, 25.0 280.7, 280.0, 276.5, 82.5, 66.6, 29.9, 25.0, 9.7 

Antibody dilution

1:500 1:500 1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Supportive: Single band corresponding to the predicted size in kDa (+/-20%) Non-supportive: Only bands not corresponding to the predicted size Supportive: Band of predicted size in kDa (+/-20%) with additional bands present 

         Protein array

Image

    

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 Application not done for this antibody. 

Antibody dilution

1:1000 1:3000 1:2000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen. Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
FLNA-001
 
FLNA-002
 
FLNA-010
 
FLNA-015
 
FLNA-201
 
FLNA-202