HMGN5

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA000511

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA000511 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

1 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

102 

Antigen sequence

LSAMLVPVTPEVKPKRTSSSRKMKTKSDMMEENIDTSAQAVAETKQEAVV
EEDYNENAKNGEAKITEAPASEKEIVEVKEENIEDATEKGGEKKEAVAAE
VK
 

Matching transcripts

HMGN5-001 - ENSP00000350848 [100%]
HMGN5-006 - ENSP00000399626 [100%]
HMGN5-007 - ENSP00000362347 [100%]
HMGN5-004 - ENSP00000408060 [97%]
 

Other gene match

 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human thyroid gland shows strong nuclear positivity in glandular cells.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:350 

Literature conformity

Partly consistent with extensive gene/protein characterization data 

RNA consistency

Not done 

         Immunofluorescence

Image

 

Description

Immunofluorescent staining of human cell line U-2 OS shows positivity in nucleus.
More information
 

Antibody dilution

1:25 

Validation IF

Supportive: The subcellular location is supported by literature. 

         Western Blot

Image

 

Description

Lane 1: Marker [kDa] 207, 110, 79, 49, 32, 25, 17.1
Lane 2: RT4
Lane 3: EFO-21
Lane 4: A-431
Lane 5: Liver
Lane 6: Tonsil
More information
 

Target mass (kDa)

31.5, 22.4, 18.0, 16.5 

Antibody dilution

1:500 

Validation WB

Uncertain: Single band differing more than +/-20% from predicted size in kDa and not supported by experimental and/or bioinformatic data 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:2000 

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen. 
 

ANTIGEN VIEW

? »
 
 
 
HMGN5-001
 
HMGN5-004
 
HMGN5-006
 
HMGN5-007