PLN

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA026900

 

Antibody CAB005597

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 Affinity BioReagents
 

Product name

HPA026900 MA3-922 

Host species

Rabbit Mouse 

Clonality

pAb mAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand Supernatant 

Released in version

5 3 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment Synthetic peptide 

Length (aa)

30  

Antigen sequence

EKVQYLTRSAIRRASTIEMPQQARQKLQNL
 
 

Matching transcripts

PLN-001 - ENSP00000350132 [100%]
  

Other gene match

  

ANTIBODY VALIDATION

         Immunohistochemistry

Image

  

Description

Immunohistochemical staining of human heart muscle shows strong cytoplasmic and nuclear membranous positivity in myocytes.
More information
 Immunohistochemical staining of human heart muscle shows strong cytoplasmic and nuclear membranous positivity.
More information
 

Retrieval method

HIER pH6 HIER pH6 

Antibody dilution

1:400 1:15000 

Validation IH

Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data Supportive: Two (or more) antibodies yielding similar staining patterns which are consistent with available gene/protein characterization data 

         Immunofluorescence

Image

  

Description

Immunofluorescent staining of human cell line U-251 MG shows positivity in nucleus but not nucleoli.
More information
 Immunofluorescent staining of human cell line A-431 shows no positivity.
More information
 

Antibody dilution

1:50 1:2000 

Validation IF

Non-supportive: The subcellular location is not consistent with literature. Uncertain: The subcellular location is partly supported by literature or no literature is available. 

         Western Blot

Image

  

Description

Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11
Lane 2: RT-4
Lane 3: U-251 MG
Lane 4: Human Plasma
Lane 5: Liver
Lane 6: Tonsil
More information
  

Target mass (kDa)

6.1 6.1 

Antibody dilution

1:250 1:500 

Validation WB

Supportive: Band of predicted size in kDa (+/-20%) with additional bands present Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

  

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
  

Antibody dilution

1:3000  

Validation PA

Supportive: Pass with single peak corresponding to interaction only with its own antigen.  
 

ANTIGEN VIEW

? »
 
 
 
PLN-001