TAP2

ANTIBODY AND ANTIGEN INFORMATION

? »
 

Antibody HPA001312

 

ANTIBODY INFORMATION

Provider

Atlas Antibodies
Sigma-Aldrich
 

Product name

HPA001312 

Host species

Rabbit 

Clonality

pAb 

Purity

Affinity purified using the PrEST-antigen as affinity ligand 

Released in version

2 

ANTIGEN INFORMATION

Antigen

Recombinant protein fragment 

Length (aa)

139 

Antigen sequence

GSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVL
FSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGS
QLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQA
 

Matching transcripts

TAP2-001 - ENSP00000364032 [100%]
TAP2-002 - ENSP00000364034 [100%]
 

Other gene match

TAP2 - ENSG00000250264 [100%]
 

ANTIBODY VALIDATION

         Immunohistochemistry

Image

 

Description

Immunohistochemical staining of human tonsil shows strong cytoplasmic positivity in cells in seminiferus ducts.
More information
 

Retrieval method

HIER pH6 

Antibody dilution

1:1000 

Literature conformity

Consistent with extensive gene/protein characterization data 

RNA consistency

Not done 

         Western Blot

Image

 

Description

 

Target mass (kDa)

93.0, 75.7, 72.0 

Antibody dilution

1:500 

Validation WB

Non-supportive: Only bands not corresponding to the predicted size 

         Protein array

Image

 

Description

Antibody specificity analysis with protein arrays. Predicted and matching interactions are shown in green.
More information
 

Antibody dilution

1:3000 

Validation PA

Uncertain: Pass with quality comment low specificity (binding to 1-2 PrESTs >15% and <40%). 
 

ANTIGEN VIEW

? »
 
 
 
TAP2-001
 
TAP2-002